![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) |
![]() | Species Escherichia coli [TaxId:562] [54727] (5 PDB entries) |
![]() | Domain d2nybc2: 2nyb C:83-192 [138809] Other proteins in same PDB: d2nyba1, d2nybb1, d2nybc1, d2nybd1 automated match to d2nyba2 complexed with fe2, o |
PDB Entry: 2nyb (more details), 1.1 Å
SCOPe Domain Sequences for d2nybc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nybc2 d.44.1.1 (C:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa
Timeline for d2nybc2: