Lineage for d2nvub1 (2nvu B:2012-2441)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011421Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 1011422Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 1011429Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (2 proteins)
    the common fold is elaborated with additional (sub)domains
  6. 1011457Protein UBA3 [89764] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains an all-alpha insert subdomain of the FF-like fold (residues 210-288) and an extra C-terminal alpha+beta subdomain (partly disordered)
  7. 1011458Species Human (Homo sapiens) [TaxId:9606] [89765] (8 PDB entries)
    Uniprot Q8TBC4 33-458
  8. 1011472Domain d2nvub1: 2nvu B:2012-2441 [138661]
    Other proteins in same PDB: d2nvua_, d2nvub2, d2nvuc1, d2nvui_, d2nvuj_
    automatically matched to d1ngvb_
    complexed with atp, mg, zn

Details for d2nvub1

PDB Entry: 2nvu (more details), 2.8 Å

PDB Description: structure of appbp1-uba3~nedd8-nedd8-mgatp-ubc12(c111a), a trapped ubiquitin-like protein activation complex
PDB Compounds: (B:) Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera

SCOPe Domain Sequences for d2nvub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvub1 c.111.1.2 (B:2012-2441) UBA3 {Human (Homo sapiens) [TaxId: 9606]}
dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsaklqevldyltns
aslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdgqelavadvttp
qtvlfklhft

SCOPe Domain Coordinates for d2nvub1:

Click to download the PDB-style file with coordinates for d2nvub1.
(The format of our PDB-style files is described here.)

Timeline for d2nvub1: