Lineage for d2nvtf1 (2nvt F:72-155)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751602Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1751603Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1751649Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 1751650Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 1751651Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 1751669Domain d2nvtf1: 2nvt F:72-155 [138653]
    Other proteins in same PDB: d2nvta1, d2nvtb1, d2nvtc1, d2nvtc2, d2nvte1, d2nvte2, d2nvth1, d2nvti1, d2nvti2, d2nvtj1, d2nvtk1, d2nvtl1
    automatically matched to d1i3qf_
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2nvtf1

PDB Entry: 2nvt (more details), 3.36 Å

PDB Description: RNA Polymerase II Elongation Complex in 150 mM Mg+2 with GMPCPP
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2nvtf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvtf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d2nvtf1:

Click to download the PDB-style file with coordinates for d2nvtf1.
(The format of our PDB-style files is described here.)

Timeline for d2nvtf1: