Lineage for d2nsub3 (2nsu B:122-189,B:383-608)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1861985Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1862313Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)
  6. 1862342Protein Transferrin receptor ectodomain, protease-like domain [53211] (1 species)
  7. 1862343Species Human (Homo sapiens) [TaxId:9606] [53212] (4 PDB entries)
  8. 1862357Domain d2nsub3: 2nsu B:122-189,B:383-608 [138551]
    Other proteins in same PDB: d2nsua1, d2nsua2, d2nsub1, d2nsub2
    automatically matched to d1cx8a3

Details for d2nsub3

PDB Entry: 2nsu (more details), 27 Å

PDB Description: crystal structure of the ectodomain of human transferrin receptor fitted into a cryo-em reconstruction of canine parvovirus and feline transferrin receptor complex
PDB Compounds: (B:) Transferrin receptor protein 1

SCOPe Domain Sequences for d2nsub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nsub3 c.56.5.5 (B:122-189,B:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]}
lywddlkrklsekldstdftstikllnensyvpreagsqkdenlalyvenefrefklskv
wrdqhfvkXeikilnifgvikgfvepdhyvvvgaqrdawgpgaaksgvgtalllklaqmf
sdmvlkdgfqpsrsiifaswsagdfgsvgatewlegylsslhlkaftyinldkavlgtsn
fkvsaspllytliektmqnvkhpvtgqflyqdsnwaskvekltldnaafpflaysgipav
sfcfcedtdypylgttmdtykelieripelnkvaraaaevagqfviklthdveln

SCOPe Domain Coordinates for d2nsub3:

Click to download the PDB-style file with coordinates for d2nsub3.
(The format of our PDB-style files is described here.)

Timeline for d2nsub3: