![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (10 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries) |
![]() | Domain d2nptb1: 2npt B:42-123 [138449] Other proteins in same PDB: d2npta1, d2nptc1 |
PDB Entry: 2npt (more details), 1.75 Å
SCOP Domain Sequences for d2nptb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nptb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]} ndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldk avelldrsihmkslkillving
Timeline for d2nptb1: