PDB entry 2npt

View 2npt on RCSB PDB site
Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
Class: transferase
Keywords: mitogen activated protein kinase kinase 5, MAP2K5, MEK5, MKK5, PRKMK5, MAP kinase kinase 5, phox, phox-domain, mitogen activated protein kinase kinase kinase 2, MAP3K2, MAPK/ERK kinase kinase 2, MAPKKK2, MEK kinase 2, MEKK2, MEKK2B, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2006-10-30, released 2006-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.202
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 5
    Species: HOMO SAPIENS
    Gene: MAP2K5, MEK5, MKK5, PRKMK5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13163 (2-105)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d2npta1
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase kinase 2
    Species: HOMO SAPIENS
    Gene: MAP3K2, MAPKKK2, MEKK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2nptb1
  • Chain 'C':
    Compound: Dual specificity mitogen-activated protein kinase kinase 5
    Species: HOMO SAPIENS
    Gene: MAP2K5, MEK5, MKK5, PRKMK5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13163 (2-105)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d2nptc1
  • Chain 'D':
    Compound: Mitogen-activated protein kinase kinase kinase 2
    Species: HOMO SAPIENS
    Gene: MAP3K2, MAPKKK2, MEKK2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2nptd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nptA (A:)
    smalgpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafey
    ededgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nptA (A:)
    smalgpfpamqvlvirikipnsgavdwtvhsqllfrdvldvigqvlpeatttafeyeded
    gdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nptB (B:)
    smslqetrkakssspkkqndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlh
    ytnnelviplttqddldkavelldrsihmkslkillving
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nptB (B:)
    ndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldk
    avelldrsihmkslkillving
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nptC (C:)
    smalgpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafey
    ededgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nptC (C:)
    smalgpfpamenqvlvirikipnsgavdwtvhqllfrdvldvigqvlpeatttafeyede
    dgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nptD (D:)
    smslqetrkakssspkkqndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlh
    ytnnelviplttqddldkavelldrsihmkslkillving
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nptD (D:)
    ssspkkqndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplt
    tqddldkavelldrsihmkslkillvin