Lineage for d2nptc1 (2npt C:4-108)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717519Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 717535Family d.15.2.2: PB1 domain [64225] (10 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 717545Protein Mitogen activated protein kinase kinase 5, Map2k5 [117827] (2 species)
  7. 717546Species Human (Homo sapiens) [TaxId:9606] [142975] (1 PDB entry)
  8. 717548Domain d2nptc1: 2npt C:4-108 [138450]
    Other proteins in same PDB: d2nptb1, d2nptd1
    automatically matched to 2NPT A:4-108

Details for d2nptc1

PDB Entry: 2npt (more details), 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
PDB Compounds: (C:) Dual specificity mitogen-activated protein kinase kinase 5

SCOP Domain Sequences for d2nptc1:

Sequence, based on SEQRES records: (download)

>d2nptc1 d.15.2.2 (C:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
malgpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafeye
dedgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

Sequence, based on observed residues (ATOM records): (download)

>d2nptc1 d.15.2.2 (C:4-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]}
malgpfpamenqvlvirikipnsgavdwtvhqllfrdvldvigqvlpeatttafeyeded
gdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra

SCOP Domain Coordinates for d2nptc1:

Click to download the PDB-style file with coordinates for d2nptc1.
(The format of our PDB-style files is described here.)

Timeline for d2nptc1: