Lineage for d2ja8f1 (2ja8 F:72-155)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926369Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 926370Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 926406Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 926407Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 926408Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 926432Domain d2ja8f1: 2ja8 F:72-155 [138229]
    Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
    automatically matched to d1i3qf_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja8f1

PDB Entry: 2ja8 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2ja8f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja8f1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d2ja8f1:

Click to download the PDB-style file with coordinates for d2ja8f1.
(The format of our PDB-style files is described here.)

Timeline for d2ja8f1: