SCOPe 2.02: Domain d2ja8e2: 2ja8 E:144-215

Lineage for d2ja8e2 (2ja8 E:144-215)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family)

5. Family d.78.1.1: RPB5 [55288] (2 proteins)

6. Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2ja8e2: 2ja8 E:144-215 [138228]
   Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
   automatically matched to d1dzfa2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja8e2

PDB Entry: 2ja8, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2ja8e2:

Sequence; same for both SEQRES and ATOM records:

>d2ja8e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d2ja8e2:

• d2ja8e2 first appeared in SCOP 1.73
  
• d2ja8e2 appears in SCOPe 2.01
  
• d2ja8e2 appears in SCOPe 2.03
  
• d2ja8e2 appears in the current release, SCOPe 2.08