Lineage for d2j02q1 (2j02 Q:2-101)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800031Protein Ribosomal protein S17 [50304] (3 species)
  7. 800061Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 800078Domain d2j02q1: 2j02 Q:2-101 [137882]
    Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
    automatically matched to 2J00 Q:2-101
    complexed with 5mu, mg, par, zn

Details for d2j02q1

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOP Domain Sequences for d2j02q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02q1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyeslskr

SCOP Domain Coordinates for d2j02q1:

Click to download the PDB-style file with coordinates for d2j02q1.
(The format of our PDB-style files is described here.)

Timeline for d2j02q1: