SCOP 1.75: Domain d2j02c2: 2j02 C:107-207

Lineage for d2j02c2 (2j02 C:107-207)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d2j02c2: 2j02 C:107-207 [137867]
   Other proteins in same PDB: d2j02b1, d2j02c1, d2j02d1, d2j02e1, d2j02e2, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
   automatically matched to d1fjgc2
   complexed with 5mu, mg, par, zn

Details for d2j02c2

PDB Entry: 2j02, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d2j02c2:

Sequence; same for both SEQRES and ATOM records:

>d2j02c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d2j02c2:

• d2j02c2 first appeared in SCOP 1.73
  
• d2j02c2 appears in SCOPe 2.01
  
• d2j02c2 appears in the current release, SCOPe 2.08