Lineage for d2j02e2 (2j02 E:5-73)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1202665Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1202666Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1202741Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
  6. 1202742Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
    lacks the N-terminal helix
  7. 1202770Species Thermus thermophilus [TaxId:274] [54781] (36 PDB entries)
    Uniprot P27152
  8. 1202784Domain d2j02e2: 2j02 E:5-73 [137870]
    Other proteins in same PDB: d2j02b1, d2j02c1, d2j02c2, d2j02d1, d2j02e1, d2j02f1, d2j02g1, d2j02h1, d2j02i1, d2j02j1, d2j02k1, d2j02l1, d2j02m1, d2j02n1, d2j02o1, d2j02p1, d2j02q1, d2j02r1, d2j02s1, d2j02t1, d2j02u1
    automatically matched to d1i94e2
    protein/RNA complex; complexed with mg, par, zn

Details for d2j02e2

PDB Entry: 2j02 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4). This file contains the 30s subunit, mrna, a-, p- and e-site trnas and paromomycin for molecule II.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2j02e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j02e2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

SCOPe Domain Coordinates for d2j02e2:

Click to download the PDB-style file with coordinates for d2j02e2.
(The format of our PDB-style files is described here.)

Timeline for d2j02e2: