Lineage for d2iyza_ (2iyz A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987470Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
  6. 987500Protein automated matches [190331] (1 species)
    not a true protein
  7. 987501Species Mycobacterium tuberculosis [TaxId:83332] [187153] (10 PDB entries)
  8. 987512Domain d2iyza_: 2iyz A: [137816]
    automated match to d1l4ua_
    complexed with adp, s3p

Details for d2iyza_

PDB Entry: 2iyz (more details), 2.3 Å

PDB Description: shikimate kinase from mycobacterium tuberculosis in complex with shikimate-3-phosphate and adp
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d2iyza_:

Sequence, based on SEQRES records: (download)

>d2iyza_ c.37.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvps

Sequence, based on observed residues (ATOM records): (download)

>d2iyza_ c.37.1.2 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrnpgavvrhilsrlqvps

SCOPe Domain Coordinates for d2iyza_:

Click to download the PDB-style file with coordinates for d2iyza_.
(The format of our PDB-style files is described here.)

Timeline for d2iyza_: