Lineage for d2ixpc_ (2ixp C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1102812Fold a.268: PTPA-like [140983] (1 superfamily)
    multihelical
  4. 1102813Superfamily a.268.1: PTPA-like [140984] (1 family) (S)
  5. 1102814Family a.268.1.1: PTPA-like [140985] (2 proteins)
    Pfam PF03095
  6. 1102833Protein automated matches [190724] (1 species)
    not a true protein
  7. 1102834Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187883] (3 PDB entries)
  8. 1102838Domain d2ixpc_: 2ixp C: [137783]
    Other proteins in same PDB: d2ixpa1
    automated match to d2ixoa1
    complexed with cl, so4

Details for d2ixpc_

PDB Entry: 2ixp (more details), 2.8 Å

PDB Description: crystal structure of the pp2a phosphatase activator ypa1 ptpa1 in complex with model substrate
PDB Compounds: (C:) serine/threonine-protein phosphatase 2a activator 1

SCOPe Domain Sequences for d2ixpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixpc_ a.268.1.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sldrvdwphatfstpvkrifdtqttldfqsslaihrikyhlhkyttlishcsdpdphata
ssiamvnglmgvldklahlidetpplpgprrygnlacrewhhklderlpqwlqemlpsey
hevvpelqyylgnsfgsstrldygtghelsfmatvaaldmlgmfphmrgadvfllfnkyy
timrrliltytlepagshgvwglddhfhlvyilgssqwqlldaqaplqpreildkslvre
ykdtnfycqginfinevkmgpfeehspilydiavtvprwskvckgllkmysvevlkkfpv
vqhfwfgtgffpwvni

SCOPe Domain Coordinates for d2ixpc_:

Click to download the PDB-style file with coordinates for d2ixpc_.
(The format of our PDB-style files is described here.)

Timeline for d2ixpc_: