Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
Species Human poliovirus 1 Mahoney [TaxId:12081] [74978] (2 PDB entries) |
Domain d2ijd11: 2ijd 1:1-180 [137474] Other proteins in same PDB: d2ijd12, d2ijd22 automatically matched to d1l1na_ complexed with so4, zn |
PDB Entry: 2ijd (more details), 3.4 Å
SCOPe Domain Sequences for d2ijd11:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ijd11 b.47.1.4 (1:1-180) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevailaak aladqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt eqgylnlggrqtartlmynfptragqaggvitctgkvigmhvggngshgfaaalkrsyft
Timeline for d2ijd11: