Lineage for d2if9b2 (2if9 B:131-260)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963166Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 2963167Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 2963174Species Simian virus 40, Sv40 [TaxId:10633] [55467] (10 PDB entries)
  8. 2963187Domain d2if9b2: 2if9 B:131-260 [137328]
    Other proteins in same PDB: d2if9a3, d2if9b3
    automated match to d1tbd__

Details for d2if9b2

PDB Entry: 2if9 (more details), 2.59 Å

PDB Description: crystal structure of sv40 t-antigen origin binding domain disulfide- linked dimer
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d2if9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2if9b2 d.89.1.1 (B:131-260) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
kvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
nhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpg
glkehdfnpe

SCOPe Domain Coordinates for d2if9b2:

Click to download the PDB-style file with coordinates for d2if9b2.
(The format of our PDB-style files is described here.)

Timeline for d2if9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2if9b3