SCOP 1.75: Domain d2idod1: 2ido D:2-76

Lineage for d2idod1 (2ido D:2-76)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Homolog of theta (HOT) [116866] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries)
   Uniprot Q71T70

8. Domain d2idod1: 2ido D:2-76 [137287]
   Other proteins in same PDB: d2idoa1, d2idoc1
   automatically matched to d1se7a_
   complexed with edo, mn, tmp

Details for d2idod1

PDB Entry: 2ido, 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex

PDB Compounds: (D:) Hot protein

SCOP Domain Sequences for d2idod1:

Sequence; same for both SEQRES and ATOM records:

>d2idod1 a.237.1.1 (D:2-76) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}
ydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhyr
qlslqlpkgsdpayq

Timeline for d2idod1:

• d2idod1 first appeared in SCOP 1.73
  
• d2idod1 is called d2idod_ in SCOPe 2.01
  
• d2idod1 appears in the current release, SCOPe 2.08, called d2idod_