SCOP 1.75: Domain d2idoc1: 2ido C:7-180

Lineage for d2idoc1 (2ido C:7-180)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III [82444] (1 species)

7. Species Escherichia coli [TaxId:562] [82445] (4 PDB entries)

8. Domain d2idoc1: 2ido C:7-180 [137286]
   Other proteins in same PDB: d2idob1, d2idod1
   automatically matched to d1j53a_
   complexed with edo, mn, tmp

Details for d2idoc1

PDB Entry: 2ido, 2.1 Å

PDB Description: Structure of the E. coli Pol III epsilon-Hot proofreading complex

PDB Compounds: (C:) DNA polymerase III epsilon subunit

SCOP Domain Sequences for d2idoc1:

Sequence; same for both SEQRES and ATOM records:

>d2idoc1 c.55.3.5 (C:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

Timeline for d2idoc1:

• d2idoc1 first appeared in SCOP 1.73
  
• d2idoc1 is called d2idoc_ in SCOPe 2.01
  
• d2idoc1 appears in the current release, SCOPe 2.08, called d2idoc_