Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (9 PDB entries) |
Domain d2icwe2: 2icw E:1-92 [137250] Other proteins in same PDB: d2icwa1, d2icwa2, d2icwb1, d2icwd1, d2icwd2, d2icwe1, d2icwg_, d2icwh_, d2icwj1, d2icwj2, d2icwl2, d2icwl3 automatically matched to d1d5xb2 |
PDB Entry: 2icw (more details), 2.41 Å
SCOPe Domain Sequences for d2icwe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2icwe2 d.19.1.1 (E:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]} gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey wnsqkdlleqrraavdtycrhnygvgesftvq
Timeline for d2icwe2: