Lineage for d2ibzf_ (2ibz F:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458053Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1458054Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1458055Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1458085Protein automated matches [190325] (4 species)
    not a true protein
  7. 1458086Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187143] (1 PDB entry)
  8. 1458087Domain d2ibzf_: 2ibz F: [137225]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
    automated match to d1ezvf_
    complexed with fes, hem, sma, uq6

Details for d2ibzf_

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOPe Domain Sequences for d2ibzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzf_ f.27.1.1 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalrr
lpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeldn
ievsk

SCOPe Domain Coordinates for d2ibzf_:

Click to download the PDB-style file with coordinates for d2ibzf_.
(The format of our PDB-style files is described here.)

Timeline for d2ibzf_: