Lineage for d2i9ta2 (2i9t A:19-190)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378032Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2378056Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2378063Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)
  8. 2378069Domain d2i9ta2: 2i9t A:19-190 [137130]
    Other proteins in same PDB: d2i9ta1, d2i9ta3, d2i9tb1, d2i9tb2
    automated match to d1gjia2
    protein/DNA complex

Details for d2i9ta2

PDB Entry: 2i9t (more details), 2.8 Å

PDB Description: structure of nf-kb p65-p50 heterodimer bound to prdii element of b- interferon promoter
PDB Compounds: (A:) Transcription factor p65

SCOPe Domain Sequences for d2i9ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9ta2 b.2.5.3 (A:19-190) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapn

SCOPe Domain Coordinates for d2i9ta2:

Click to download the PDB-style file with coordinates for d2i9ta2.
(The format of our PDB-style files is described here.)

Timeline for d2i9ta2: