Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
Protein DNA polymerase beta [81579] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [81575] (107 PDB entries) |
Domain d2i9ga2: 2i9g A:92-148 [137127] Other proteins in same PDB: d2i9ga1, d2i9ga3 automatically matched to d1bpxa3 protein/DNA complex; complexed with bpi, cl, na |
PDB Entry: 2i9g (more details), 2.1 Å
SCOPe Domain Sequences for d2i9ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9ga2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek
Timeline for d2i9ga2: