SCOP 1.73: Domain d2hyma2: 2hym A:110-212

Lineage for d2hyma2 (2hym A:110-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89200] (3 PDB entries)

8. Domain d2hyma2: 2hym A:110-212 [136899]
   Other proteins in same PDB: d2hymb1
   automatically matched to d1n6ua2

Details for d2hyma2

PDB Entry: 2hym

PDB Description: nmr based docking model of the complex between the human type i interferon receptor and human interferon alpha-2

PDB Compounds: (A:) Soluble IFN alpha/beta receptor

SCOP Domain Sequences for d2hyma2:

Sequence; same for both SEQRES and ATOM records:

>d2hyma2 b.1.2.1 (A:110-212) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppgqesefs

Timeline for d2hyma2:

• d2hyma2 is new in SCOP 1.73
  
• d2hyma2 appears in SCOP 1.75
  
• d2hyma2 appears in the current release, SCOPe 2.08