SCOPe 2.01: Domain d2hxqa1: 2hxq A:2-276

Lineage for d2hxqa1 (2hxq A:2-276)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
   CaMK group; CAMKL subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [64405] (41 PDB entries)

8. Domain d2hxqa1: 2hxq A:2-276 [136858]
   automatically matched to d1ia8a_
   complexed with 373

Details for d2hxqa1

PDB Entry: 2hxq, 2 Å

PDB Description: crystal structure of Chek1 in complex with inhibitor 2

PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d2hxqa1:

Sequence, based on SEQRES records:

>d2hxqa1 d.144.1.7 (A:2-276) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkkgakrp

Sequence, based on observed residues (ATOM records):

>d2hxqa1 d.144.1.7 (A:2-276) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnh
envvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgi
githrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrref
haepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhk
ilvenpsaritipdikkdrwynkplkkgakrp

Timeline for d2hxqa1:

• d2hxqa1 first appeared in SCOP 1.73
  
• d2hxqa1 appears in SCOP 1.75
  
• d2hxqa1 appears in SCOPe 2.02
  
• d2hxqa1 appears in the current release, SCOPe 2.08, called d2hxqa_