SCOPe 2.08: Domain d2hvya2: 2hvy A:11-252

Lineage for d2hvya2 (2hvy A:11-252)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Pyrococcus furiosus [TaxId:2261] [143434] (2 PDB entries)
   Uniprot Q7LWY0 5-249

8. Domain d2hvya2: 2hvy A:11-252 [136818]
   Other proteins in same PDB: d2hvya1, d2hvyb1, d2hvyc1, d2hvyd1
   automatically matched to 2EY4 A:8-252
   protein/RNA complex; complexed with atp, zn
   has additional insertions and/or extensions that are not grouped together

Details for d2hvya2

PDB Entry: 2hvy, 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus

PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOPe Domain Sequences for d2hvya2:

Sequence, based on SEQRES records:

>d2hvya2 d.265.1.2 (A:11-252) Pseudouridine synthase II TruB {Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirslihhi
glalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekav
eh

Sequence, based on observed residues (ATOM records):

>d2hvya2 d.265.1.2 (A:11-252) Pseudouridine synthase II TruB {Pyrococcus furiosus [TaxId: 2261]}
rilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevvawik
kilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedkiiq
vmkefegeiiqrppllrtrkvyyievleiegrdvlfrvgveagtyirslihhiglalgvg
ahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpmekaveh

Timeline for d2hvya2:

• d2hvya2 first appeared in SCOP 1.73
  
• d2hvya2 appears in SCOPe 2.07