Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins) automatically mapped to Pfam PF02254 |
Protein Ktn bsu222 [75118] (1 species) |
Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries) |
Domain d2hmwb_: 2hmw B: [136618] automated match to d2hmva_ complexed with atp |
PDB Entry: 2hmw (more details), 3 Å
SCOPe Domain Sequences for d2hmwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmwb_ c.2.1.9 (B:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} qfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellslg irnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpekd mgvkiaqslsdenvlny
Timeline for d2hmwb_: