Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein) duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family |
Protein Aspartokinase [143391] (3 species) |
Species Methanococcus jannaschii [TaxId:2190] [143392] (1 PDB entry) Uniprot Q57991 304-403! Uniprot Q57991 404-470 |
Domain d2hmfc2: 2hmf C:404-470 [136580] Other proteins in same PDB: d2hmfa1, d2hmfb1, d2hmfc1, d2hmfd1 automated match to d2hmfa2 complexed with adp, asp, mg |
PDB Entry: 2hmf (more details), 2.7 Å
SCOPe Domain Sequences for d2hmfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmfc2 d.58.18.10 (C:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl hekfiek
Timeline for d2hmfc2: