Lineage for d2hhkm_ (2hhk M:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239027Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1239028Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1239029Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1239184Protein automated matches [190224] (5 species)
    not a true protein
  7. 1239196Species Rhodobacter sphaeroides [TaxId:1063] [186985] (37 PDB entries)
  8. 1239215Domain d2hhkm_: 2hhk M: [136500]
    automated match to d1ystm_
    complexed with bcl, bph, cdl, cl, fe, gol, k, lda, pgk, pgt, po4, u10

Details for d2hhkm_

PDB Entry: 2hhk (more details), 2.5 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylglycerol
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d2hhkm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhkm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d2hhkm_:

Click to download the PDB-style file with coordinates for d2hhkm_.
(The format of our PDB-style files is described here.)

Timeline for d2hhkm_: