SCOPe 2.01: Domain d2hg3l_: 2hg3 L:

Lineage for d2hg3l_ (2hg3 L:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (29 PDB entries)

8. Domain d2hg3l_: 2hg3 L: [136391]
   automated match to d1aigl_
   complexed with bcl, bph, cdl, fe, gol, hto, k, lda, pc9, po4, u10

Details for d2hg3l_

PDB Entry: 2hg3, 2.7 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with brominated phosphatidylcholine

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2hg3l_:

Sequence; same for both SEQRES and ATOM records:

>d2hg3l_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2hg3l_:

• d2hg3l_ first appeared in SCOP 1.73, called d2hg3l1
  
• d2hg3l_ was called d2hg3l1 in SCOP 1.75
  
• d2hg3l_ appears in SCOPe 2.02
  
• d2hg3l_ appears in the current release, SCOPe 2.08