Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Recoverin [47533] (1 species) Calcium-myristoyl switch; only one EF-hand is functional |
Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries) |
Domain d2hetc_: 2het C: [136358] automated match to d2d8na_ complexed with ca |
PDB Entry: 2het (more details), 3 Å
SCOPe Domain Sequences for d2hetc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hetc_ a.39.1.5 (C:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf ep
Timeline for d2hetc_: