Lineage for d2hetc_ (2het C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734252Protein Recoverin [47533] (1 species)
    Calcium-myristoyl switch; only one EF-hand is functional
  7. 1734253Species Cow (Bos taurus) [TaxId:9913] [47534] (11 PDB entries)
  8. 1734263Domain d2hetc_: 2het C: [136358]
    automated match to d2d8na_
    complexed with ca

Details for d2hetc_

PDB Entry: 2het (more details), 3 Å

PDB Description: Non-myristoylated bovine recoverin (truncated at C-terminus) with calcium bound to EF-hand 3
PDB Compounds: (C:) Recoverin

SCOPe Domain Sequences for d2hetc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hetc_ a.39.1.5 (C:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}
lskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpeadpkayaqh
vfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtisknevleivta
ifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlankeilrliqf
ep

SCOPe Domain Coordinates for d2hetc_:

Click to download the PDB-style file with coordinates for d2hetc_.
(The format of our PDB-style files is described here.)

Timeline for d2hetc_: