SCOPe 2.01: Domain d2h3la_: 2h3l A:

Lineage for d2h3la_ (2h3l A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Erbin [82085] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82086] (4 PDB entries)

8. Domain d2h3la_: 2h3l A: [136046]
   automated match to d1n7ta_

Details for d2h3la_

PDB Entry: 2h3l, 1 Å

PDB Description: crystal structure of erbin pdz

PDB Compounds: (A:) LAP2 protein

SCOPe Domain Sequences for d2h3la_:

Sequence; same for both SEQRES and ATOM records:

>d2h3la_ b.36.1.1 (A:) Erbin {Human (Homo sapiens) [TaxId: 9606]}
gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
qpgdkiiqangysfiniehgqavsllktfqntveliivrevss

Timeline for d2h3la_:

• d2h3la_ first appeared in SCOP 1.73, called d2h3la1
  
• d2h3la_ was called d2h3la1 in SCOP 1.75
  
• d2h3la_ appears in SCOPe 2.02
  
• d2h3la_ appears in the current release, SCOPe 2.08, called d2h3la2