Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
Protein Thiol:disulfide interchange protein DsbG, C-terminal domain [110610] (1 species) |
Species Escherichia coli [TaxId:562] [110611] (5 PDB entries) Uniprot P77202 |
Domain d2h0ha1: 2h0h A:62-230 [135933] Other proteins in same PDB: d2h0ha2, d2h0hb2 automated match to d1v58a1 complexed with so4; mutant |
PDB Entry: 2h0h (more details), 1.8 Å
SCOPe Domain Sequences for d2h0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0ha1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyceqfwqqarp wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq mkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgn
Timeline for d2h0ha1: