SCOPe 2.05: Domain d2gtfx_: 2gtf X:

Lineage for d2gtfx_ (2gtf X:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
   Uniprot Q26241

8. Domain d2gtfx_: 2gtf X: [135648]
   automated match to d1euoa_
   complexed with hem, p1r

Details for d2gtfx_

PDB Entry: 2gtf, 1.4 Å

PDB Description: crystal structure of nitrophorin 2 complex with pyrimidine

PDB Compounds: (X:) Nitrophorin-2

SCOPe Domain Sequences for d2gtfx_:

Sequence; same for both SEQRES and ATOM records:

>d2gtfx_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

Timeline for d2gtfx_:

• d2gtfx_ first appeared in SCOP 1.73, called d2gtfx1
  
• d2gtfx_ appears in SCOPe 2.04
  
• d2gtfx_ is called d2gtfx2 in SCOPe 2.06
  
• d2gtfx_ appears in the current release, SCOPe 2.08, called d2gtfx2