SCOPe 2.05: Domain d2grla1: 2grl A:1-66

Lineage for d2grla1 (2grl A:1-66)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (8 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)

8. Domain d2grla1: 2grl A:1-66 [135560]
   Other proteins in same PDB: d2grla2, d2grlb2, d2grlc2, d2grld2
   automated match to d2awia1

Details for d2grla1

PDB Entry: 2grl, 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex

PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2grla1:

Sequence; same for both SEQRES and ATOM records:

>d2grla1 a.35.1.0 (A:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnrag

Timeline for d2grla1:

• d2grla1 first appeared in SCOP 1.73
  
• d2grla1 appears in SCOPe 2.04
  
• d2grla1 appears in SCOPe 2.06
  
• d2grla1 appears in the current release, SCOPe 2.08