SCOPe 2.05: Domain d2gimc_: 2gim C:

Lineage for d2gimc_ (2gim C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (16 species)

7. Species Anabaena variabilis [TaxId:1172] [49517] (4 PDB entries)

8. Domain d2gimc_: 2gim C: [135245]
   automated match to d1fa4a_
   complexed with cu

Details for d2gimc_

PDB Entry: 2gim, 1.6 Å

PDB Description: 1.6 angstrom structure of plastocyanin from anabaena variabilis

PDB Compounds: (C:) plastocyanin

SCOPe Domain Sequences for d2gimc_:

Sequence; same for both SEQRES and ATOM records:

>d2gimc_ b.6.1.1 (C:) Plastocyanin {Anabaena variabilis [TaxId: 1172]}
metytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksl
shkqllmspgqststtfpadapageytfycephrgagmvgkitvag

Timeline for d2gimc_:

• d2gimc_ first appeared in SCOP 1.73, called d2gimc1
  
• d2gimc_ appears in SCOPe 2.04
  
• d2gimc_ appears in SCOPe 2.06
  
• d2gimc_ appears in the current release, SCOPe 2.08