Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (14 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (106 PDB entries) Uniprot P02593 |
Domain d2ggmb1: 2ggm B:25-166 [135153] automatically matched to d1cfc__ protein/DNA complex; complexed with ca |
PDB Entry: 2ggm (more details), 2.35 Å
SCOPe Domain Sequences for d2ggmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ggmb1 a.39.1.5 (B:25-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} lteeqkqeireafdlfdadgtgtidvkelkvamralgfepkkeeikkmiseidkegtgkm nfgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelqe mideadrdgdgevseqeflrim
Timeline for d2ggmb1: