Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries) |
Domain d2gdsc2: 2gds C:84-198 [135029] Other proteins in same PDB: d2gdsa1, d2gdsb1, d2gdsc1, d2gdsd1 automatically matched to d1em1a2 complexed with mn; mutant |
PDB Entry: 2gds (more details), 2.3 Å
SCOP Domain Sequences for d2gdsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdsc2 d.44.1.1 (C:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
Timeline for d2gdsc2: