Lineage for d2gdsb1 (2gds B:1-83)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760309Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 760310Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 760436Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 760489Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)
  8. 760535Domain d2gdsb1: 2gds B:1-83 [135026]
    Other proteins in same PDB: d2gdsa2, d2gdsb2, d2gdsc2, d2gdsd2
    automatically matched to d1em1a1
    complexed with mn; mutant

Details for d2gdsb1

PDB Entry: 2gds (more details), 2.3 Å

PDB Description: interrupting the hydrogen bonding network at the active site of human manganese superoxide dismutase
PDB Compounds: (B:) superoxide dismutase

SCOP Domain Sequences for d2gdsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdsb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d2gdsb1:

Click to download the PDB-style file with coordinates for d2gdsb1.
(The format of our PDB-style files is described here.)

Timeline for d2gdsb1: