SCOP 1.75: Domain d2gdsd2: 2gds D:84-198

Lineage for d2gdsd2 (2gds D:84-198)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (27 PDB entries)

8. Domain d2gdsd2: 2gds D:84-198 [135031]
   Other proteins in same PDB: d2gdsa1, d2gdsb1, d2gdsc1, d2gdsd1
   automatically matched to d1em1a2
   complexed with mn; mutant

Details for d2gdsd2

PDB Entry: 2gds, 2.3 Å

PDB Description: interrupting the hydrogen bonding network at the active site of human manganese superoxide dismutase

PDB Compounds: (D:) superoxide dismutase

SCOP Domain Sequences for d2gdsd2:

Sequence; same for both SEQRES and ATOM records:

>d2gdsd2 d.44.1.1 (D:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d2gdsd2:

• d2gdsd2 first appeared in SCOP 1.73
  
• d2gdsd2 appears in SCOPe 2.01
  
• d2gdsd2 appears in the current release, SCOPe 2.08