Lineage for d2g9xd1 (2g9x D:172-309)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331206Species Cow (Bos taurus) [TaxId:9913] [47958] (11 PDB entries)
  8. 2331229Domain d2g9xd1: 2g9x D:172-309 [134848]
    Other proteins in same PDB: d2g9xa2, d2g9xa3, d2g9xb3, d2g9xc2, d2g9xc3, d2g9xd3
    automated match to d1finb1
    complexed with nu5

Details for d2g9xd1

PDB Entry: 2g9x (more details), 2.5 Å

PDB Description: Structure of Thr 160 phosphorylated CDK2/cyclin A in complex with the inhibitor NU6271
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d2g9xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9xd1 a.74.1.1 (D:172-309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
vnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnet
lhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqv
lrmehlvlkvlafdlaap

SCOPe Domain Coordinates for d2g9xd1:

Click to download the PDB-style file with coordinates for d2g9xd1.
(The format of our PDB-style files is described here.)

Timeline for d2g9xd1: