Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47958] (11 PDB entries) |
Domain d2g9xb2: 2g9x B:310-432 [134846] Other proteins in same PDB: d2g9xa2, d2g9xa3, d2g9xb3, d2g9xc2, d2g9xc3, d2g9xd3 automated match to d4eojb2 complexed with nu5 |
PDB Entry: 2g9x (more details), 2.5 Å
SCOPe Domain Sequences for d2g9xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9xb2 a.74.1.1 (B:310-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} tinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvtg qswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d2g9xb2: