Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries) |
Domain d2g4wb_: 2g4w B: [134614] automated match to d1a2wa_ complexed with cl, so4 |
PDB Entry: 2g4w (more details), 1.84 Å
SCOPe Domain Sequences for d2g4wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g4wb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf dasv
Timeline for d2g4wb_: