SCOPe 2.06: Domain d2g4wb_: 2g4w B:

Lineage for d2g4wb_ (2g4w B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d2g4wb_: 2g4w B: [134614]
   automated match to d1a2wa_
   complexed with cl, so4

Details for d2g4wb_

PDB Entry: 2g4w, 1.84 Å

PDB Description: anomalous substructure of ribonuclease A (C2)

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d2g4wb_:

Sequence; same for both SEQRES and ATOM records:

>d2g4wb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2g4wb_:

• d2g4wb_ first appeared in SCOP 1.73, called d2g4wb1
  
• d2g4wb_ appears in SCOPe 2.05
  
• d2g4wb_ appears in SCOPe 2.07
  
• d2g4wb_ appears in the current release, SCOPe 2.08