Lineage for d2g0tb_ (2g0t B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1164938Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1165114Protein Hypothetical protein TM0796 [142299] (1 species)
    member of Pfam PF07755; DUF1611; contains extra N-terminal alpha/beta fold of Rossmann-fold topology, parallel beta-sheet, strand order 312456
  7. 1165115Species Thermotoga maritima [TaxId:2336] [142300] (1 PDB entry)
    Uniprot Q9WZQ3 1-338
  8. 1165117Domain d2g0tb_: 2g0t B: [134500]
    automated match to d2g0ta1
    complexed with edo, fmt, po4

Details for d2g0tb_

PDB Entry: 2g0t (more details), 2.67 Å

PDB Description: Crystal structure of a putative nucleotide binding protein (tm0796) from Thermotoga maritima at 2.67 A resolution
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2g0tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g0tb_ c.37.1.10 (B:) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]}
hmdlwklyqpgtpaaivawgqlgtahakttygllrhsrlfkpvcvvaehegkmasdfvkp
vrydvpvvssvekakemgaevliigvsnpggyleeqiatlvkkalslgmdvisglhfkis
qqteflkiahengtriidirippleldvlrggiyrkkikvvgvfgtdcvvgkrttavqlw
eralekgikagflatgqtgiligadagyvidavpadfvsgvvekavlklektgkeivfve
gqgalrhpaygqvtlgllygsnpdvvflvhdpsrdhfesfpeipkkpdfeeerrlietls
nakviggvslnggfetdlpvydpfntddldemleramvw

SCOPe Domain Coordinates for d2g0tb_:

Click to download the PDB-style file with coordinates for d2g0tb_.
(The format of our PDB-style files is described here.)

Timeline for d2g0tb_: