Lineage for d2fzea2 (2fze A:163-338)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826590Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 1826611Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1826716Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 1826725Domain d2fzea2: 2fze A:163-338 [134434]
    Other proteins in same PDB: d2fzea1, d2fzeb1
    automated match to d1m6ha2
    complexed with apr, k, po4, zn

Details for d2fzea2

PDB Entry: 2fze (more details), 1.9 Å

PDB Description: crystal structure of the binary complex of human glutathione-dependent formaldehyde dehydrogenase with adp-ribose
PDB Compounds: (A:) Alcohol dehydrogenase class III chi chain

SCOPe Domain Sequences for d2fzea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzea2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
apldkvcllgcgistgygaavntaklepgsvcavfglggvglavimgckvagasriigvd
inkdkfarakefgatecinpqdfskpiqevliemtdggvdysfecignvkvmraaleach
kgwgvsvvvgvaasgeeiatrpfqlvtgrtwkgtafggwksvesvpklvseymskk

SCOPe Domain Coordinates for d2fzea2:

Click to download the PDB-style file with coordinates for d2fzea2.
(The format of our PDB-style files is described here.)

Timeline for d2fzea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fzea1