Lineage for d2fmsa3 (2fms A:149-335)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229335Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1229336Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 1229344Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1229345Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 1229346Species Human (Homo sapiens) [TaxId:9606] [81574] (107 PDB entries)
    Uniprot P06746
  8. 1229349Domain d2fmsa3: 2fms A:149-335 [133794]
    Other proteins in same PDB: d2fmsa1, d2fmsa2
    automatically matched to d1bpxa4
    protein/DNA complex; complexed with cl, dup, mg, na

Details for d2fmsa3

PDB Entry: 2fms (more details), 2 Å

PDB Description: DNA Polymerase beta with a gapped DNA substrate and dUMPNPP with magnesium in the catalytic site
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d2fmsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmsa3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens) [TaxId: 9606]}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOPe Domain Coordinates for d2fmsa3:

Click to download the PDB-style file with coordinates for d2fmsa3.
(The format of our PDB-style files is described here.)

Timeline for d2fmsa3: