Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) |
Domain d2flrt1: 2flr T:6-108 [133748] Other proteins in same PDB: d2flrh_ automatically matched to d1a21a1 complexed with 7nh |
PDB Entry: 2flr (more details), 2.35 Å
SCOPe Domain Sequences for d2flrt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2flrt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagnvestgsageplyenspeftpyletnl
Timeline for d2flrt1: