SCOPe 2.07: Domain d2fjyb_: 2fjy B:

Lineage for d2fjyb_ (2fjy B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Moth pheromone-binding protein, PBP [47569] (2 species)

7. Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (4 PDB entries)

8. Domain d2fjyb_: 2fjy B: [133627]
   automated match to d1gm0a_

Details for d2fjyb_

PDB Entry: 2fjy, 2.3 Å

PDB Description: crystal structure of b-form bombyx mori pheromone binding protein

PDB Compounds: (B:) pheromone-binding protein

SCOPe Domain Sequences for d2fjyb_:

Sequence; same for both SEQRES and ATOM records:

>d2fjyb_ a.39.2.1 (B:) Moth pheromone-binding protein, PBP {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev

Timeline for d2fjyb_:

• d2fjyb_ first appeared in SCOP 1.73, called d2fjyb1
  
• d2fjyb_ appears in SCOPe 2.06
  
• d2fjyb_ appears in the current release, SCOPe 2.08