SCOPe 2.06: Domain d2fhpb2: 2fhp B:1-183

Lineage for d2fhpb2 (2fhp B:1-183)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.46: YhhF-like [142611] (6 proteins)
   Pfam PF03602

6. Protein automated matches [190639] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [187705] (1 PDB entry)

8. Domain d2fhpb2: 2fhp B:1-183 [133496]
   Other proteins in same PDB: d2fhpa1, d2fhpa2, d2fhpb3
   automated match to d2fhpa1

Details for d2fhpb2

PDB Entry: 2fhp, 1.6 Å

PDB Description: Crystal Structure of Putative Methylase from Enterococcus faecalis

PDB Compounds: (B:) methylase, putative

SCOPe Domain Sequences for d2fhpb2:

Sequence, based on SEQRES records:

>d2fhpb2 c.66.1.46 (B:1-183) automated matches {Enterococcus faecalis [TaxId: 226185]}
mrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglaieav
srgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlld
ppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiy
rqe

Sequence, based on observed residues (ATOM records):

>d2fhpb2 c.66.1.46 (B:1-183) automated matches {Enterococcus faecalis [TaxId: 226185]}
mrvisgeyggrrlkaldgtdkvkesifnmigpyfdggmaldlysgsgglaieavsrgmdk
sicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlldppyakq
eivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiyrqe

Timeline for d2fhpb2:

• d2fhpb2 first appeared in SCOP 1.73, called d2fhpb1
  
• d2fhpb2 was called d2fhpb_ in SCOPe 2.05
  
• d2fhpb2 appears in SCOPe 2.07
  
• d2fhpb2 appears in the current release, SCOPe 2.08