Lineage for d2fh5a1 (2fh5 A:1-129)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922955Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 1922988Family d.110.4.4: SRP alpha N-terminal domain-like [90019] (2 proteins)
  6. 1922989Protein Signal recognition particle receptor alpha subunit, N-terminal domain [143735] (1 species)
  7. 1922990Species Human (Homo sapiens) [TaxId:9606] [143736] (2 PDB entries)
    Uniprot P08240 1-129
  8. 1922991Domain d2fh5a1: 2fh5 A:1-129 [133477]
    Other proteins in same PDB: d2fh5b1
    complexed with gtp, mg

Details for d2fh5a1

PDB Entry: 2fh5 (more details), 2.45 Å

PDB Description: The Structure of the Mammalian SRP Receptor
PDB Compounds: (A:) Signal recognition particle receptor alpha subunit

SCOPe Domain Sequences for d2fh5a1:

Sequence, based on SEQRES records: (download)

>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqerggnnsfthealtlkykldn
qfelvfvvgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrl
lreaeessk

Sequence, based on observed residues (ATOM records): (download)

>d2fh5a1 d.110.4.4 (A:1-129) Signal recognition particle receptor alpha subunit, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mvdfftifskgglvlwcfqgvsdsctgpvnalirsvllqethealtlkykldnqfelvfv
vgfqkiltltyvdkliddvhrlfrdkyrteiqqqsalsllngtfdfqndflrllreaees
sk

SCOPe Domain Coordinates for d2fh5a1:

Click to download the PDB-style file with coordinates for d2fh5a1.
(The format of our PDB-style files is described here.)

Timeline for d2fh5a1: